PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.J00411.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 184aa    MW: 20075.3 Da    PI: 6.9456
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.J00411.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1811e-5632125295
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                       reqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisfvtseasdkcqrekrktingddllwa+atlGfedy++plkvyl++yre +
  Migut.J00411.3.p  32 REQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKVYLARYREGD 124
                       89****************************************************************************************966 PP

             NF-YB  95 g 95 
                       +
  Migut.J00411.3.p 125 T 125
                       5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.2E-5329148IPR009072Histone-fold
SuperFamilySSF471134.79E-4034150IPR009072Histone-fold
PfamPF008082.6E-2837101IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.3E-206583No hitNo description
PROSITE patternPS0068506884IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.3E-2084102No hitNo description
PRINTSPR006151.3E-20103121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MADGLSSQEA PGSPNGGSHD SGGDLSPRSG YREQDRFLPI ANISRIMKKA LPANGKIAKD  60
AKETVQECVS EFISFVTSEA SDKCQREKRK TINGDDLLWA MATLGFEDYI DPLKVYLARY  120
REGDTKGSGK NADGSSRKDG LQQQIPNSQS QHVHQGSFSQ GMNYGNVQQQ AQHMMVKMQG  180
MDQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A6e-4830122193NF-YB
4csr_A6e-4830122294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B6e-4830122294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012831929.11e-134PREDICTED: nuclear transcription factor Y subunit B-1-like
RefseqXP_012831930.11e-134PREDICTED: nuclear transcription factor Y subunit B-1-like
SwissprotQ8VYK43e-81NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A0V0HS791e-100A0A0V0HS79_SOLCH; Putative nuclear transcription factor Y subunit B-10-like
STRINGVIT_13s0019g03600.t014e-92(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.32e-82nuclear factor Y, subunit B8